SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000018791 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000018791
Domain Number 1 Region: 245-411
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.76e-44
Family SPRY domain 0.00037
Further Details:      
 
Domain Number 2 Region: 16-83
Classification Level Classification E-value
Superfamily RING/U-box 4.48e-16
Family RING finger domain, C3HC4 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000018791   Gene: ENSSSCG00000017737   Transcript: ENSSSCT00000019304
Sequence length 423
Comment pep:known_by_projection chromosome:Sscrofa10.2:12:44417875:44431444:1 gene:ENSSSCG00000017737 transcript:ENSSSCT00000019304 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAGPDAGPAIPVWLAEDDLGCIICHELLAWPTTLPCGHSFCRDCLVGLWEAGRRRSCPTC
REGGAQPLQLRKNTMLQDLADKYSRAAHELKDRAPVPGPAPRPAPGPRCHTAQLRVAAQK
SITEVGRELAELVDQLVDTVRSLQSQSCLPESEPDKDLRTLASALSDGVDLSLASPKLVT
SNTPEAKMRDILHDLKKIQGKLQENFTWKGALEEQKQVDITEALSSSSSLLPDQSHLVPK
RASSFAQWAISPTFDLGSLSCSLEVSEDHRTVTVSHYPQSYPWSPERFASCQVLGSQGFS
SGQRYWEVDTQRCSHWAVGVASRGMRRDQILGRTSDSWCVEWNGASQLSAWHVVKQTVLG
SDRPGVVGIWLDFEKEKLAFYSVADQEKLLYEYPVSASFALYPAFWLYGLYPGNSLTVRQ
VNL
Download sequence
Identical sequences F1RKW3
ENSSSCP00000018791 XP_003131783.1.46622 ENSSSCP00000018791 9823.ENSSSCP00000018791

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]