SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000019007 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000019007
Domain Number 1 Region: 513-678
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.000000095
Family SPRY domain 0.029
Further Details:      
 
Domain Number 2 Region: 44-205
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.00000135
Family SPRY domain 0.074
Further Details:      
 
Weak hits

Sequence:  ENSSSCP00000019007
Domain Number - Region: 718-877
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.00791
Family SPRY domain 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000019007   Gene: ENSSSCG00000017941   Transcript: ENSSSCT00000019525
Sequence length 1555
Comment pep:known chromosome:Sscrofa10.2:3:139944072:139956595:-1 gene:ENSSSCG00000017941 transcript:ENSSSCT00000019525 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAGSGGSGGSGGGPGPGPGGGGGPGGSGSGPGSAGELHPRTGRLVSLSACGRTARRQQP
GQEFNHGLVLSREPLRDGRVFTVRIDRKVNSWSGSIEIGVTALDPSVLDFPSSATGLKGG
SWVVSGCSVLRDGRSVLEEYGQDLDQLGEGDRVGVERTVAGELRLWVNGRDCGVAATGLP
ARVWAVVDLYGKCTQITVLPPEPGFSPPTPIPTPPLEPSAPPEDSALAEQGTSGDEAFMV
SPAQARPETFPNSLESHNDFANMELSEVVSNAILSAYNGGLLNVNLSSPPAGEAPGPSGA
ATSPILTSNDALLFHEKCGTLIKLSNNNKTAERRRPLDEFNNGVVMTNRPLRDNEMFEIR
IDKLVDKWSGSIEIGVTTHNPNNLEYPATMTNLQSGTIMMSGCGILTNGKGTRREYCEFS
LDELQEGDHIGLTRKSNSALHFFINGIDQGVATPLTPPVVYGVVDLYGMAVKVTIVHNNN
HSDRLRRNNAILRALSPEGALRRAAPAAQAEPERLLFHPNCGQKAAITHEGRTALRPHAT
DDFNHGVVLSSRALRDGEVFQVRIDKMVDKWAGSIEIGVTTHNPAYLQLPSTMTNLRSGT
WMMTGNGVMHNGTTILDEYGHNLDRLKAGDTVGVVRREDGTLHFFVNGMTQGPAAWNVPP
GVYAVVDLYGQAAQATIVDDVEVPPVPEPLPEGNNQASPSSPSSGAGGSDLRFHQLHGSN
AVITNGGRTALRHNCRSEFNDAIVISNRALRDGELFEIVIQKMVDRWSGSIEAGVTAIRP
EDLEFPNTMTDIDYDTWMLSGTAIMQDGNTMRNNYGCDLDALGTGARIGMMRTAKGDLHY
FINGQDQGAACSGLPPGKEVYAVVDLYGQCVQVSITNATGPMDNSLATSNSATEKSFPLH
SPVAGVAHRFHSTCGKNITLEEDGTRAVRAAGYAHGLVFSTKELKTEEVFEVKVEELDEK
WAGSLRLGLTTLVPGDMGPGAGGGPGLPPSLPELRTKTTWMVSSCEVRRDGQLQRMNYGR
NLERLGVGSRVGLRRGADDTMHILVDGEDMGPAATGIAKNVWAVLDLYGPVRSVSIVSST
RLDEPEGTQPPSPSSDTGSEGEEEDEGEEHGPEGQDQVAVMPTALEFLENHGKNILLSNG
NRTATRVASYNQGIVVVNQPLVPQLLVQVRIDFLNRQWTSSLVLGVITCPPERLNFPASA
CALKRAAWLLRGRGVFHNGLKVAGGGGPNLXTCPEGTILGLRLDGSGGLHLHINGLDQGV
AVPDVPQPCHALVDLYGQCEQVTIVSPEPGAASGKSTGTQGDMEKADMVDGIKESVCWGP
PPTASPLKSCEYHALCSRFQELLLLPEDYFLPPPKRSLCYCESCRKLRGDEAHRRRGEPP
REYALPFGWCRFNLRVNPRLEAGTLTKKWHMAYHGSNVAAVRRVLDRGELGAGTASILSC
RPLKGEPGGGFEEPGENCAPPREEQPPPVLLSPSLQYAGAETLASKVQFRDPKSQRTHQA
QVAFQVCVRPGSYTPGPPSAALREPPDPHFSPAELEWVTKEKGATLLYALLVRVE
Download sequence
Identical sequences ENSSSCP00000019007 ENSSSCP00000019007

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]