SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000019024 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000019024
Domain Number 1 Region: 1-124
Classification Level Classification E-value
Superfamily Cysteine proteinases 3.34e-37
Family Adenain-like 0.0000933
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000019024   Gene: ENSSSCG00000017958   Transcript: ENSSSCT00000019542
Sequence length 127
Comment pep:novel chromosome:Sscrofa10.2:12:55307123:55308270:-1 gene:ENSSSCG00000017958 transcript:ENSSSCT00000019542 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VDIFNKELLLIPIHLEVHWSLISVDVRRRTITYFDSQRTLNRRCPKHIAKYLQAEAVKKD
RLDFHQGWKGYFKMNVARQNNDSDCGAFVLQYCKHLALSQPFSFTQQDMPKLRRQIYKEL
CHCKLTV
Download sequence
Identical sequences ENSSSCP00000019024 ENSSSCP00000019024 9823.ENSSSCP00000019024

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]