SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000019119 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000019119
Domain Number 1 Region: 3-433
Classification Level Classification E-value
Superfamily ALDH-like 1.28e-130
Family ALDH-like 0.00000000000266
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000019119   Gene: ENSSSCG00000018044   Transcript: ENSSSCT00000019639
Sequence length 488
Comment pep:known_by_projection chromosome:Sscrofa10.2:12:62638752:62645604:-1 gene:ENSSSCG00000018044 transcript:ENSSSCT00000019639 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
IGEVVQRARAAFLSGRTRPLQFRIQQLEGLRRLIREREKDLVGALTADLHKNEWNAYYEE
MVYVLEEIEHVIKKLPEWAADEPVEKTPQTQQDEPYIHSEPLGVVLIIGAWNYPFNLTIQ
PMVGAIAAGNAVVIKPSELSENTERLLATLIPQYLDKDLYHVVTGGVPETTELLKERFDH
ILYTGSPGIGKVVMTAAAKHLTPVTLELGGKNPCYVDKDCDLDVACRRIAWGKFMNSGQT
CVGPDYILCDPSIQNQIVEKLKKSLKEFYGEDARKSRDYGRIINSRHFQRVMGLLEGQKV
AYGGTGDAATRYIAPTILTDVDPQSQVMQEEIFGPLMPIVCVGSLEEAIRFINQREKPLA
LYVFSLHDKVIQKMIAETSSGGVTANDVIVHITVPSLPFGGVGNSGMGSYHGKKSFETFS
HRRSCLVRPLLNEETLRARYPPSPAKQASRRHRFICEAPNPTRSGLILFPNCFLSVFFSG
LRNGLKNI
Download sequence
Identical sequences 9823.ENSSSCP00000019119 ENSSSCP00000019119 ENSSSCP00000019119

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]