SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000019330 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000019330
Domain Number 1 Region: 15-75
Classification Level Classification E-value
Superfamily SH2 domain 5.25e-17
Family SH2 domain 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000019330   Gene: ENSSSCG00000026779   Transcript: ENSSSCT00000027973
Sequence length 75
Comment pep:novel chromosome:Sscrofa10.2:8:129881481:129908979:1 gene:ENSSSCG00000026779 transcript:ENSSSCT00000027973 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGRAESPEGEMSTQDPLDLWSRLDGEAEPLQDLGWYHGNLTRHAAEALLLSNGRDGSYLL
RDSNEKTGLYSLSVR
Download sequence
Identical sequences ENSSSCP00000019330 ENSSSCP00000019330

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]