SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000019401 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000019401
Domain Number 1 Region: 123-351
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 7.29e-61
Family Eukaryotic proteases 0.00000021
Further Details:      
 
Domain Number 2 Region: 4-73
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000195
Family Complement control module/SCR domain 0.0001
Further Details:      
 
Domain Number 3 Region: 70-139
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000113
Family Complement control module/SCR domain 0.0000507
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000019401   Gene: ENSSSCG00000020832   Transcript: ENSSSCT00000026124
Sequence length 352
Comment pep:novel scaffold:Sscrofa10.2:GL894248.2:5570:12782:1 gene:ENSSSCG00000020832 transcript:ENSSSCT00000026124 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AQPCPDPVAPPNGHISPVQAKYILKDRFFVFCETGYELLQGDLPLKSFTTVCQKDGSWDQ
PMPECSIVDCGPPDDLQNGQVEYITAPEVTTYKAEMRYRCNAFYTMRIDHGKYVCEADGF
WMRSKGDKSLPVCEPVCGLSTRTTEGRIYGGQKAKLGDFPWQVLLFGETMAAGALVSDDW
ILTAAHAVYKQKEDASSLDIRLGVLKRLSPHYTQAWAEAIFIHEGYTHNAGYDNDIALIK
LKDKVVINSNVMPICLPRKEAESFMRTNDIGTASGWGLTQRGFLARNLMSADLPIVDHQK
CVAAFEKKSDPGVRVTDNMLCAGLESGGKDSCKGDSGGALVFLDDETQKWFV
Download sequence
Identical sequences ENSSSCP00000019401 ENSSSCP00000019401

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]