SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000019430 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000019430
Domain Number 1 Region: 122-228
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000000000106
Family Cadherin 0.0041
Further Details:      
 
Domain Number 2 Region: 375-532
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.00000000000592
Family Laminin G-like module 0.054
Further Details:      
 
Domain Number 3 Region: 57-134
Classification Level Classification E-value
Superfamily Cadherin-like 0.000000143
Family Cadherin 0.0081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000019430   Gene: ENSSSCG00000030549   Transcript: ENSSSCT00000023475
Sequence length 890
Comment pep:novel scaffold:Sscrofa10.2:GL892953.2:108168:143816:-1 gene:ENSSSCG00000030549 transcript:ENSSSCT00000023475 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VNKHKPWLEPTYHGLVTESDSAVLLDPPLIALDKDAPLRFAESFEVTVTKEGEICGFKIH
GQNVPFDAVVVDKSTGEGIIRSKEKLDCELQKDYTFTIQAYDCGKGPDGANVKKSHKATV
HIQVNDVNEYAPVFKEKSYKATVVEGKQYDSILRVEAVDADCSPQFSQICSYDIVTPDVP
FTIDKDGYIKNTEKLTYGKERQYKLTVTAYDCGKKRATEDVLVKISIKPTCTPGWQGWNN
RVEYEPGTGALALFPNVHLETCDASVASVQVAVELETSHIGKGCDRDTYSEKSLHRLCEG
KCRGKGVLLASAKKCLVWHRXLPTDNGHDSDQVFEFNGTQAVRIPDGVLCSSDKTEKPTS
VRFYTLPQPAPGSSKSVKETALIELLFADMNRHHYSLCIFLLRQDPSEEKKYKPAEFHWK
LHQVCDEEWHHYVLNVDIPSVVLYVDGASHEPFSVTEDYPLHPSSIETQLVVGACWQEYS
GVENDNETEPEPMASAGGDLHMTQFFRGNLAGLTIRSGKLADKKVIDCLYTCKEGLELHL
PEGVDTDQSFQIHATPSQSVLTLEGEDVGDLDKAMQHIAYLNSRQFPTPGIRRLKITTTV
TCFSEATTCISIPPQDGYVMVLQPEEPKISLSGIHHFXARAASEFESSEGVFLFPELRII
STITREVEPEGEGDEDPTVQESLVSEEIVHDLDTCEVTVEGEELNREQETLEVDTARLQQ
KGIEVSSSDLGMVFTGVDTMASYEEVLHLLRYRNWHTRSLLDRKFKLVCSELNGRYVSNE
FQVEVNVIHTANPVDHASHMAAQPQFVHPETRSQVGLWPSQLSHPLLPAVVPSTATVVIV
VCVSFLXFRIRAAHQRTMRDQDSGKENEMDWDDSALTITVNPMETYEDQX
Download sequence
Identical sequences ENSSSCP00000019430 ENSSSCP00000019430

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]