SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000019508 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000019508
Domain Number 1 Region: 8-143
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 2.39e-34
Family Phosphate binding protein-like 0.0001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000019508   Gene: ENSSSCG00000026950   Transcript: ENSSSCT00000023074
Sequence length 237
Comment pep:known chromosome:Sscrofa10.2:14:93524851:93531494:1 gene:ENSSSCG00000026950 transcript:ENSSSCT00000023074 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGSRLQGLTLKVVTVLEEPFVMVAENILGQPKRYKGFSIDVLDALAKALGFKYEIYQAPD
GRYGHQLHNTSWNGMIGELISKRADLAISAITITPERESVVDFSKRYMDYSVGILIRKPE
EKISIFSLFAPFDFAVWACIAAAIPVVGVLIFVLNRIQAVRAQSAAQPRPSASATLHSAI
WIVYGAFVQQGGESSVNSMAMRIVMGSWWLFTLIVCSSYTANLAAFLTVSRMDNPIR
Download sequence
Identical sequences ENSSSCP00000019508 ENSSSCP00000019508

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]