SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000019577 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000019577
Domain Number 1 Region: 47-84
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000117
Family EGF-type module 0.018
Further Details:      
 
Domain Number 2 Region: 9-130
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000502
Family Growth factor receptor domain 0.019
Further Details:      
 
Domain Number 3 Region: 198-237
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000921
Family EGF-type module 0.011
Further Details:      
 
Domain Number 4 Region: 149-184
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000021
Family EGF-type module 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000019577   Gene: ENSSSCG00000022228   Transcript: ENSSSCT00000027770
Sequence length 283
Comment pep:novel chromosome:Sscrofa10.2:2:72634804:72644177:1 gene:ENSSSCG00000022228 transcript:ENSSSCT00000027770 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
NECTDTTMCPAYATCTNTSDSYYCSCKRGFLSTNGQMQFKVEGLLGVDVNECANPKTCPE
HAICRNSVGSYSCVCKPGFESSRGKTSVQGPGQMCRDGDECSRNSTPCGASSACTNLLGK
YNCSCLPGFSPPDFWASGRGGSLVGSCCDINECLQSGVCPEHSQCTNSLGSYSCSCHVGF
TSTNSICEGRSILATMTLFSCPDIDECSQSPPVCGPHSICKNLPGRYRCSCLTGFSSPTG
NNWILGKKGRFICTGNMLERNSSLALESILTKRCAHILGRALG
Download sequence
Identical sequences ENSSSCP00000019577

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]