SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000019614 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000019614
Domain Number 1 Region: 20-252
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.57e-78
Family Eukaryotic proteases 0.000018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000019614   Gene: ENSSSCG00000023074   Transcript: ENSSSCT00000030045
Sequence length 254
Comment pep:known chromosome:Sscrofa10.2:6:51488847:51493150:-1 gene:ENSSSCG00000023074 transcript:ENSSSCT00000030045 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTAAGNPWGWFLGYLLLGITGSLAFINGGHIINGEDCNPHSQPWQAALFLEDDFFCGGVL
VHPQWVLSAAHCFQNSYTIGLGLHNLEPEQEPGSQMMEASLSIQHPEYNEPSMANDLMLI
KLKESVSLSDTVRNISVVSQCPTPGDSCLVSGWGRLASGRLPQVLQCVNISVASEEVCKA
RYGPVYHPSMFCAGGGQDQKDSCHGDSGGPLICNGSLQGLVSFGQAQCGQPNVPGVYTNL
CKFTDWIQTTIQAS
Download sequence
Identical sequences Q9XSN6
ENSSSCP00000019614 NP_998967.1.46622 ENSSSCP00000019614

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]