SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000019654 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000019654
Domain Number 1 Region: 22-225
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 7.07e-42
Family Pentraxin (pentaxin) 0.0000000459
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000019654   Gene: ENSSSCG00000021186   Transcript: ENSSSCT00000029314
Sequence length 225
Comment pep:known_by_projection chromosome:Sscrofa10.2:4:98754378:98757413:1 gene:ENSSSCG00000021186 transcript:ENSSSCT00000029314 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEKQLWCFLVLISFSNAFGQSDLHKKAFVFPQESDNSYVSLKAQLKKPLKAFTVCLHIYS
ELASTRGYSVFSYATKKQPNEILIFWSKGRGYILGVRGTEVLFKSPENTAAPTHICASWE
SASGIAEFWVDGKPKVRKSLEKGASVEAEASIILGQEQDTFAGEYEKNQCLVGDIGDVNM
WDYVLSPEEISTVYAGGTFSPNVLNWRALSYEMSGEVYVKPQLWP
Download sequence
Identical sequences ENSSSCP00000019654 ENSSSCP00000019654 XP_003355155.1.46622

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]