SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000019699 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000019699
Domain Number 1 Region: 1-75
Classification Level Classification E-value
Superfamily Sema domain 2.75e-24
Family Sema domain 0.00000969
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000019699   Gene: ENSSSCG00000022472   Transcript: ENSSSCT00000029128
Sequence length 75
Comment pep:novel chromosome:Sscrofa10.2:9:106632158:106636175:1 gene:ENSSSCG00000022472 transcript:ENSSSCT00000029128 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MYNPVFPINNRPIMIKTDVNYQFTQIVVDRVDAEDGQYDVMFIGTDVGTVLKVVSIPKET
WHDLEEVLLEEMTVF
Download sequence
Identical sequences ENSSSCP00000019699 ENSSSCP00000019699

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]