SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000019717 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000019717
Domain Number 1 Region: 2-174
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 4.71e-59
Family Eukaryotic proteases 0.000000166
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000019717   Gene: ENSSSCG00000021867   Transcript: ENSSSCT00000029557
Sequence length 186
Comment pep:known_by_projection chromosome:Sscrofa10.2:6:40095731:40101161:1 gene:ENSSSCG00000021867 transcript:ENSSSCT00000029557 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGVQAVIYHGDYLPFRDPNSEENSNDIALVHLSSSLVLTEYIQPVCLPAAGQALVDGKIC
TVTGWGNTQYYGQQAGVLQEARVPIISNDVCNGPDFYGNQIKPKMFCAGYPEGGIDACQG
DSGGPFVCEDSISRTPRWRLCGIVSWGTGCALAQKPGVYTKVSDFREWIFQAIKTHSEAS
GMVTQL
Download sequence
Identical sequences ENSSSCP00000019717 ENSSSCP00000019717

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]