SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000019848 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000019848
Domain Number 1 Region: 181-363
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 5.31e-38
Family Laminin G-like module 0.0061
Further Details:      
 
Domain Number 2 Region: 17-182
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.15e-36
Family Laminin G-like module 0.0037
Further Details:      
 
Domain Number 3 Region: 567-593,628-765
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 9.68e-32
Family Laminin G-like module 0.0035
Further Details:      
 
Domain Number 4 Region: 806-1010
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.19e-29
Family Laminin G-like module 0.016
Further Details:      
 
Domain Number 5 Region: 422-480
Classification Level Classification E-value
Superfamily Fibrinogen C-terminal domain-like 0.000000000344
Family Fibrinogen C-terminal domain-like 0.0035
Further Details:      
 
Domain Number 6 Region: 394-430
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000758
Family EGF-type module 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000019848   Gene: ENSSSCG00000023125   Transcript: ENSSSCT00000031944
Sequence length 1145
Comment pep:known_by_projection scaffold:Sscrofa10.2:GL892946.2:84167:186803:-1 gene:ENSSSCG00000023125 transcript:ENSSSCT00000031944 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LDLHWGKKNSLGRECNVYSCALGSEVVDLDGKSSLLYRFDQKSLSPIKDIISLKFKTTQS
YGVLLHWEGLNGDHITLELRRGKLYFLINSGDAKLASSHAPTSLTLGSLLDDQHWHSVLI
QRLGRQVNLTVDEHKHHFHAQGEFGYLHLDYEISFGGIPAPGKSVSFPHKNFHGCLENLY
YNGVDIIDLAKQQNPQIIIMGNVSFSCSQPQSVPVTFLSPRSYLALPGASREDEVSATFQ
FRTWNKAGLLLFSELQLVSGGLLLFLNDGKLKLNLYRPGKLPSDITAGVGLNDGQWHSVS
LFAKRNYLSVTVDGQVASAAPSMGPEHIYSGGSYYFGGCPDNSVASKCRSPLSGFQGCMR
LISISHKVVDLISVQQGSLGNFSDLQIDSCGITDRCLPNYCEHGGECSQSWDTFHCNCAN
TGYSGATCHNSIYEQSCEAYKHRGNTSGFYYIDSDGSGPLEPFLLYCNMTETAWTIIQHN
GSDITRVRNTNPENPYAGSFKYVASLEQLQATINHAEYCEQELTYYCRKSRLVNEKDGTP
LSWWVGRTNETQTYWGGSLPDLQKCACGLEGNCIDSQYSCNCDADRNEWTNDTGFLSYKE
HLPVTKIVITDTHRPHSEAAYKLGPLLCRGDRLFWNSASFNTEASYLHFPTFHGELSADV
SFFFKTTASSGVFLENLGITDYIRIELRSPAVVTFSFDVGNGPSEISVQSPTHFNDNQWH
HVRVERNIKEASVQVDQLSPRRQPAPADGHVLLQLNSQLFVGGTATRQRGFXQLNGVALD
LEERAKVTPGVEPGCRGHCSSYGKLCHHGGKCREKPSGFSCDCTSSAYTGPFCSDEISAY
FGSGASIIYNFQENYSLSKNSSSHAASFQGDVKLSRETIKFSFRTTRTPSLLLYVSSFYK
EYLSVIIARNGSLQIRYKLNRYQEPDVVNFDFKNMADGQLHHIKINREEAVVFVEIDENA
RRQVHLASGTELSAIRSLVLGRILEHSEVDQETALAGAQGFLGCLSAVQLSHVAPLKAAL
HPSRPAPITILGHVTESSCVAQAGTDATSRERTHSFADHSGTRDGREPLTNTIKSDSAII
GGLIAVVIFILLCITAIAVRIYQQKRLYKRNEAKRSENVDSAEAVLKSELNIQHAVGENQ
KEYFF
Download sequence
Identical sequences ENSSSCP00000019848 ENSSSCP00000019848

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]