SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000019930 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000019930
Domain Number 1 Region: 34-157
Classification Level Classification E-value
Superfamily Cupredoxins 1.89e-39
Family Ephrin ectodomain 0.0000286
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000019930   Gene: ENSSSCG00000027694   Transcript: ENSSSCT00000023858
Sequence length 202
Comment pep:novel scaffold:Sscrofa10.2:GL894570.2:21557:24457:1 gene:ENSSSCG00000027694 transcript:ENSSSCT00000023858 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SALILFLSSFLAFLFLSSPLSLSFLTMAFFLALNCRLLRGDAVVELGLKDYLDIFCPHYE
SPGPPEGPETFALYMVDWSGYEACQAEGPGAFKRWECSRPFAPFGPVRFSEKIQRFTPFS
LGFEFLPGETYYYISVPTPESPGQCLRLQVSVCCKEDKPESAHPVGSPGESGTSGWQGGA
TPSPLCLLLLLLLPILRLLRVL
Download sequence
Identical sequences ENSSSCP00000019930 ENSSSCP00000019930

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]