SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000019990 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000019990
Domain Number 1 Region: 338-494,539-578
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.01e-45
Family SPRY domain 0.011
Further Details:      
 
Weak hits

Sequence:  ENSSSCP00000019990
Domain Number - Region: 109-157
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.0125
Family PHD domain 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000019990   Gene: ENSSSCG00000021898   Transcript: ENSSSCT00000023044
Sequence length 607
Comment pep:known_by_projection chromosome:Sscrofa10.2:15:55512104:55552504:-1 gene:ENSSSCG00000021898 transcript:ENSSSCT00000023044 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
WRAGTGPGPGVGAETGPNSAVNATPAEEGETKPVAAVAAPAGEGTSVTPAAEPVSGEAES
GDANSVDVSGGLETESSNGKDTLEGAGDTSEVMDTQAGSVDEENGRQLGEVELQCGICTK
WFTADTFGIDTSSCLPFMTNYSFHCNVCHHSGNTYFLRKQANLKEMCLSALANLTWQSRT
QDEHPKTMFSKDKDIIPFIDKYWECMTTRQRPGKMTWPNNIVKTMSKERDVFLVKEHPDP
GSKDPEEDYPKFGLLDQDLSNIGPAYDNQKQSSTVSTSGNLNGGIAAGSSGKGRGAKRKQ
QDGGTTGTTKKARSDPLFSAQRLPPHGYPLEHPFNKDGYRYILAEPDPHAPDPEKLELDC
WAGKPIPGDLYRACLYERVLLALHDRAPQLKISDDRLTVVGEKGYSMVRASHGVRKGAWY
FEITVDEMPPDTAARLGWSQPLGNLQAPLGYDKFSYSWRSKKGTKFHQSIGKHYSSGYGQ
GDVLGFYINLPEDTETAKSLPDTYKDKALIKFKSYLYFEEKDFVDKAEKSLKQTPHSEII
FYKNGVNQGVAYKDIFEGVYFPAISLYKSCTVSINFGPCXQYPPKDLAYRPMSDMXWGAV
VHTLADV
Download sequence
Identical sequences ENSSSCP00000019990 ENSSSCP00000019990

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]