SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000020010 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000020010
Domain Number 1 Region: 124-324
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 9.79e-57
Family Prokaryotic proteases 0.00000146
Further Details:      
 
Domain Number 2 Region: 337-432
Classification Level Classification E-value
Superfamily PDZ domain-like 1.28e-21
Family HtrA-like serine proteases 0.0016
Further Details:      
 
Domain Number 3 Region: 69-94
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.000000554
Family Ovomucoid domain III-like 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000020010   Gene: ENSSSCG00000026608   Transcript: ENSSSCT00000026862
Sequence length 435
Comment pep:known chromosome:Sscrofa10.2:15:54681387:54698687:-1 gene:ENSSSCG00000026608 transcript:ENSSSCT00000026862 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RTLLRPAGLRQLLLLWLLLPHAPGAGVEARTVRPAPPCPAVCEPMRCPPLPSCSAGTAPV
LTVRVLAGAAVCGSDGRTYPNLCALRARNHAARLRGGLPAVHAHEVDCGDPGTRSAGWLR
SKYNFIAEVVEKVAPSVVHLQLFSRDRSPLSNKDVPASSASGFIVSEDGLIVTNAHVLTN
RHRIQVELQNGVQYEATVKDIDHKLDLALIKIEPKTDLPVLLLGKSSDLRAGEFVVALGS
PFSLQNTVTAGIVSTTQRGGKELGLKDSDMDYIQTDAIINHGNSGGPLVNLDGDVIGINT
LKVTAGISFAIPSDRIRQFLAEFHERQLKGKALSQKKYLGLRMLPLTMNLLQDMKRQDPD
FPDVSSGVFVYEVIQGTAAESSGLRDHDVIVSINGQPVSTTTDVIEAVKANDFLSILVRR
KSQTLILTVTPEIID
Download sequence
Identical sequences ENSSSCP00000020010 ENSSSCP00000020010

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]