SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000020032 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000020032
Domain Number 1 Region: 150-280,432-483,528-675
Classification Level Classification E-value
Superfamily Cysteine proteinases 1.2e-101
Family Ubiquitin carboxyl-terminal hydrolase, UCH 0.00000971
Further Details:      
 
Domain Number 2 Region: 6-91
Classification Level Classification E-value
Superfamily RING/U-box 1.18e-23
Family Zf-UBP 0.00000532
Further Details:      
 
Domain Number 3 Region: 672-772
Classification Level Classification E-value
Superfamily DUSP-like 8.37e-21
Family DUSP, domain in ubiquitin-specific proteases 0.01
Further Details:      
 
Domain Number 4 Region: 768-877
Classification Level Classification E-value
Superfamily DUSP-like 7.06e-18
Family DUSP, domain in ubiquitin-specific proteases 0.0069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000020032   Gene: ENSSSCG00000020921   Transcript: ENSSSCT00000026836
Sequence length 901
Comment pep:known_by_projection chromosome:Sscrofa10.2:6:125758945:125798579:1 gene:ENSSSCG00000020921 transcript:ENSSSCT00000026836 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSAFRSHCPHLDSVGEITKEDLIQKSHGCCQDCKVRGPNLWACLENRCSYVGCGESQVDH
STIHSQETKHYLTVNLTTLRVWCYACSKEVFLDRKLGTQPSLPHVKPLHQTQENSVQDFK
IPSNTTLKTPLVAVFDDLDIEVEEEDELKARGLTGLKNIGNTCYMNAALQALSNCPPLTQ
FFLDCGGLARTDKKPACKSYLKLMTELWHKSRPGSVVPTNLFQGIKTVNPTFRGYSQQDA
QEFLRCLMDLLHEELKEQVMEVEENLQTVTTEETMEEDKSQSDVDFQSCESCNSSDKAEN
ENGCRSFSEDNNETTMLIQDDENNSEILKDWQKEKMCNKINKVNSEGELDKDRDSVSETV
DLNSQETVKVQIHGRASEYITDVHLNDLSTPQILPSNEGVNPRLSASPPKSGNLWPGLAP
THKKAQSASSPKRKKQHKKYRSVISDIFDGTIISSVQCLTCDRVSVTLETFQDLSLPIPG
KEDLAKLHSSSHPTSIVKAGSCGEAYAPQGWIAFFMEYVKSWFWGPVVTLQDCLAAFFAR
DELKGDNMYSCEKCKKLRNGVKFCKVQKFPEILCIHLKRFRHELMFSTKISTHVSFPLEG
LDLQPFLAKDSPTQIVTYDLLSVICHHGTASSGHYIAYCRNNLNNLWYEFDDQSVTEVSE
STVQNAEAYVLFYRKSSEEAQKERRRISNLLNIMEPSLLQFYISRQWLNKFKTFAEPGPI
SNNDFLCIHGGVPPRKASYIEDLVLMLPQNIWDNLYSRYGGGPAVNHLYICHTCQIEAEK
IEKRRKTELEIFIRLNRAFQEEDSPATFYCISMQWFREWESFVKGKDGENPPNNKIGSVK
MGYYIYLILGADSGQISEETWNFLQSIYGGGPEVILRPPVVHVDPDVLQAEEKIEVETRS
L
Download sequence
Identical sequences ENSSSCP00000020032 ENSSSCP00000020032

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]