SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000020044 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000020044
Domain Number 1 Region: 23-168
Classification Level Classification E-value
Superfamily EF-hand 1.55e-48
Family Calmodulin-like 0.00000113
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000020044   Gene: ENSSSCG00000028613   Transcript: ENSSSCT00000030417
Sequence length 172
Comment pep:known_by_projection scaffold:Sscrofa10.2:GL892891.1:45377:45895:-1 gene:ENSSSCG00000028613 transcript:ENSSSCT00000030417 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASSFKKPQVASTSQKRKVGPKPELTEDQKQEVREAFDLFDADGSGTIDVKELKVAMRAL
GFEPRKEEMKRMISEVDKEGTGKISFNDFLAVMTQKMAEKDTKEEILKAFRLFDDDETGK
ISFKNLKRVANELGENLTDEELQEMIDEADRDGDGEVNEEEFLRIMKKTNLY
Download sequence
Identical sequences I3L7N8
ENSSSCP00000020044 XP_003360829.1.46622 ENSSSCP00000020044

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]