SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000020128 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000020128
Domain Number 1 Region: 14-132
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 2.6e-38
Family Eukaryotic proteases 0.0064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000020128   Gene: ENSSSCG00000026998   Transcript: ENSSSCT00000025565
Sequence length 132
Comment pep:known scaffold:Sscrofa10.2:GL894367.1:241:3789:1 gene:ENSSSCG00000026998 transcript:ENSSSCT00000025565 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LKLKPVDGHCALESKYVKTVCLPDSPFPSGTECYISGWGVTETGEGSRQLLDAKVKLISN
AVCNSRRLYDHMLDDNMICAGNLQKPGQDSCQGDSGGPLTCEKDDAYYVYGIVSWGLECG
KKPGVYTQVTTF
Download sequence
Identical sequences ENSSSCP00000020128 ENSSSCP00000020128

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]