SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000020135 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000020135
Domain Number 1 Region: 35-135,161-193
Classification Level Classification E-value
Superfamily Thioesterase/thiol ester dehydrase-isomerase 5.04e-26
Family 4HBT-like 0.00018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000020135   Gene: ENSSSCG00000024950   Transcript: ENSSSCT00000030193
Sequence length 200
Comment pep:known chromosome:Sscrofa10.2:2:30987742:31245698:1 gene:ENSSSCG00000024950 transcript:ENSSSCT00000030193 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTSWVPRLLPRNVRSLAASSENQRVEDGRRHQEAYGYFLPIQTRWQDNDQYGHVNNAVYY
SYFDTIINHYLIRYCGLKTGLRTSPTVGFMVTNQCTFHTPVGFPQIPVAALAVDKVGRSS
VHYRLALFPPKPAGDLPAVEHRDFSDGFFFGHPRLAQFAALACTTGSAVHVFVNPATGKP
TGLPEDFRPGLLRLVTQLPK
Download sequence
Identical sequences I3L7X7
ENSSSCP00000020135 ENSSSCP00000020135

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]