SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000020199 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000020199
Domain Number 1 Region: 9-132
Classification Level Classification E-value
Superfamily DNA clamp 9.42e-16
Family DNA polymerase processivity factor 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000020199   Gene: ENSSSCG00000009824   Transcript: ENSSSCT00000027736
Sequence length 427
Comment pep:known_by_projection chromosome:Sscrofa10.2:14:33791265:33825597:1 gene:ENSSSCG00000009824 transcript:ENSSSCT00000027736 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLKCGLSGSQVKVFGKAIQALSRISDELWLDPSEKGLALRSVNSCRSAYGCVLFSPVFFQ
HYQWSASVKMNDSDKISNLNCKLGMKSILPIFRCLNSLERNVEKCKIFTRSDKCKVVIQF
FCRHGIKRIHNVCFQESQPLQVIFEKNMCTNMLVIQPRVLAEAIVLFTSSQEEVTLAVTP
LNVCIKSSNEESMDLTSSVYSEMFVGPEEFDFFQVGVDTEITFCFKELKGILTFSEATRA
PISIHFDFPGKPMALSIDDMLLEANFILATLADEPSRTSSPQSLCLSQKRKSISNLIHSS
SKADENVTSKAPEYISRQAVPKRLYSNETPSNIPALENCGSPLAKRMHGDISEVPESSVS
DTEEMPGSPYLRKFSCMFFGAVSSDQQEHFNHPFDSLATASDSEEGKSSLKFFKEFNGSD
AKKLFLY
Download sequence
Identical sequences ENSSSCP00000010487 ENSSSCP00000020199

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]