SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000020399 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000020399
Domain Number 1 Region: 396-510,630-776
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 2.06e-65
Family Phosphate binding protein-like 0.00000000125
Further Details:      
 
Domain Number 2 Region: 3-384
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 6.73e-63
Family L-arabinose binding protein-like 0.0063
Further Details:      
 
Domain Number 3 Region: 527-629
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 0.000022
Family Voltage-gated potassium channels 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000020399   Gene: ENSSSCG00000030565   Transcript: ENSSSCT00000027751
Sequence length 883
Comment pep:known_by_projection chromosome:Sscrofa10.2:9:39464926:39841255:1 gene:ENSSSCG00000030565 transcript:ENSSSCT00000027751 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGAFPSSVQIGGLFIRNTDQEYTAFRLAIFLHNTSPNASEAPFNLVPHVDNIETANSFAV
TNAFCSQYSRGVFAIFGLYDKRSVHTLTSFCSALHISLITPSFPTEGESQFVLQLRPSLR
GALLSLLDHYEWNCFVFLYDTDRGYSILQAIMEKAGQNGWHVSAICVENFNDVSYRQLLE
ELDRRQEKKFVIDCEIERLQNILEQIVSVGKHVKGYHYIIANLGFKDISLERFIHGGANV
TGFQLVDFNTPMVTKLMDRWKKLDQREYPGSETPPKYTSALTYDGVLVMAETFRNLRRQK
IDISRRGNAGDCLANPAAPWGQGIDMERTLKQVQIQGLTGNVQFDHYGRRVNYTMDVFEL
KSTGPRKVGYWNDMDKLVLIQDVPTLGNDTAAIENRTVVVTTIMESPYVMYKKNHEMFEG
NDKYEGYCVDLASEIAKHIGIKYKIAIVPDGKYGARDADTKIWNGMVGELVYGKAEIAIA
PLTITLVREEVIDFSKPFMSLGISIMIKKPQKSKPGVFSFLDPLAYEIWMCIVFAYIGVS
VVLFLVSRFSPYEWHTEEPEDGKEGPSDQPPNEFGIFNSLWFSLGAFMQQGCDISPRSLS
GRIVGGVWWFFTLIIISSYTANLAAFLTVERMVSPIESAEDLAKQTEIAYGTLDSGSTKE
FFRRSKIAVYEKMWTYMRSAEPSVFTRTTAEGVARVRKSKGKFAFLLESTMNEYIEQRKP
CDTMKVGGNLDSKGYGVATPKGSSLRNAVNLAVLKLNEQGLLDKLKNKWWYDKGECGSGG
GDSKDKTSALSLSNVAGVFYILVGGLGLAMLVALIEFCYKSRAEAKRMKLTFSEAIRNKA
RLSITGSVGENGRVLTPDCPKAVHTGTAIRQSSGLAVIASDLP
Download sequence
Identical sequences ENSSSCP00000020399 ENSSSCP00000020399

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]