SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000020473 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000020473
Domain Number 1 Region: 2-79
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.000000000000297
Family Laminin G-like module 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000020473   Gene: ENSSSCG00000022338   Transcript: ENSSSCT00000026150
Sequence length 225
Comment pep:novel chromosome:Sscrofa10.2:9:120686270:120906148:-1 gene:ENSSSCG00000022338 transcript:ENSSSCT00000026150 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MANGQPHSVNITRHEKTIILKLDHYPSVSYHLPSSSDTLFNSPKSLFLGKVIETGKIDQE
IHKYNTPGFTGCLSRVQFNQIAPLKAALRQTNASAHVHVQGELVESNCGASPLTLSPMSS
ATDPWHLDHLDSASADFPYNPGQGQAIRNGVNRNSAIIGGVIAVVIFTILCTLVFLIRYM
FRHKGTYHTNEAKGAESAESADAAIMNNDPNFTETIDESKKEWLI
Download sequence
Identical sequences ENSSSCP00000020473 ENSSSCP00000020473

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]