SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000020556 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000020556
Domain Number 1 Region: 102-475
Classification Level Classification E-value
Superfamily Cysteine proteinases 5.49e-93
Family Ubiquitin carboxyl-terminal hydrolase, UCH 0.00000000000131
Further Details:      
 
Domain Number 2 Region: 4-92
Classification Level Classification E-value
Superfamily Ubiquitin-like 2.05e-24
Family Ubiquitin-related 0.00000866
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000020556   Gene: ENSSSCG00000022559   Transcript: ENSSSCT00000027919
Sequence length 488
Comment pep:known_by_projection scaffold:Sscrofa10.2:GL896447.1:66754:107624:-1 gene:ENSSSCG00000022559 transcript:ENSSSCT00000027919 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
YGLFAVTVKWGKEKFEGVELNTDEPPMVFKAQLFALTGVQPARQKVMVKGGTLKDDDWGN
IKIKNGMTLLMMGSADALPEEPSAKTVFVEDMTEEQLASAMELPCGLTNLGNTCYMNATV
QCIRSVPELKDALKRYAGALRASGEMASAQYITAALRDLFDSMDKTSSSIPPIILLQFLH
MAFPQFAEKGEQGQYLQQDANECWIQMMRVLQQKLEAIEDDTVKETDSSSASAVTPSKKK
SLIDQFFGVEFETTMKCTESEEEEVTKGKENQLQLSCFINQEVKYLFTGLKLRLQEEITK
QSPTLQRNALYIKSSKISRLPAYLTIQMVRFFYKEKESVNAKVLKDVKFPLMLDVYELCT
PELSFRSKFKDLEDKKVNQQPKASDKKSSPQKEVKYEPFSFADDIGSNNCGYYDLQAVLT
HQGRSSSSGHYVSWVKRKQDEWIKFDDDKVSIVTPEDILRLSGGGDWHIAYVLLYGPRRV
EIMEEESE
Download sequence
Identical sequences ENSSSCP00000020556 ENSSSCP00000020556

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]