SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000020592 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000020592
Domain Number 1 Region: 658-727
Classification Level Classification E-value
Superfamily FnI-like domain 0.0000000000000241
Family VWC domain 0.0052
Further Details:      
 
Domain Number 2 Region: 423-489
Classification Level Classification E-value
Superfamily FnI-like domain 0.000000000000188
Family VWC domain 0.0089
Further Details:      
 
Domain Number 3 Region: 1564-1636
Classification Level Classification E-value
Superfamily FnI-like domain 0.000000000000575
Family VWC domain 0.011
Further Details:      
 
Domain Number 4 Region: 221-280
Classification Level Classification E-value
Superfamily FnI-like domain 0.0000000000068
Family VWC domain 0.01
Further Details:      
 
Domain Number 5 Region: 776-842
Classification Level Classification E-value
Superfamily FnI-like domain 0.00000000000743
Family VWC domain 0.0087
Further Details:      
 
Domain Number 6 Region: 107-165
Classification Level Classification E-value
Superfamily FnI-like domain 0.0000000000209
Family VWC domain 0.022
Further Details:      
 
Domain Number 7 Region: 954-1020
Classification Level Classification E-value
Superfamily FnI-like domain 0.0000000000272
Family VWC domain 0.02
Further Details:      
 
Domain Number 8 Region: 1108-1173
Classification Level Classification E-value
Superfamily FnI-like domain 0.000000000146
Family VWC domain 0.017
Further Details:      
 
Domain Number 9 Region: 367-430
Classification Level Classification E-value
Superfamily FnI-like domain 0.000000000314
Family VWC domain 0.03
Further Details:      
 
Domain Number 10 Region: 1500-1571
Classification Level Classification E-value
Superfamily FnI-like domain 0.000000000827
Family VWC domain 0.032
Further Details:      
 
Domain Number 11 Region: 1321-1380
Classification Level Classification E-value
Superfamily FnI-like domain 0.00000000607
Family VWC domain 0.0078
Further Details:      
 
Domain Number 12 Region: 1373-1448
Classification Level Classification E-value
Superfamily FnI-like domain 0.0000000105
Family VWC domain 0.01
Further Details:      
 
Domain Number 13 Region: 717-779
Classification Level Classification E-value
Superfamily FnI-like domain 0.0000000167
Family VWC domain 0.029
Further Details:      
 
Domain Number 14 Region: 171-220
Classification Level Classification E-value
Superfamily FnI-like domain 0.0000000178
Family VWC domain 0.0027
Further Details:      
 
Domain Number 15 Region: 603-665
Classification Level Classification E-value
Superfamily FnI-like domain 0.0000000251
Family VWC domain 0.0032
Further Details:      
 
Domain Number 16 Region: 897-950
Classification Level Classification E-value
Superfamily FnI-like domain 0.0000000481
Family VWC domain 0.07
Further Details:      
 
Domain Number 17 Region: 1905-1970
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.000000196
Family ATI-like 0.054
Further Details:      
 
Domain Number 18 Region: 543-600
Classification Level Classification E-value
Superfamily FnI-like domain 0.000000418
Family VWC domain 0.086
Further Details:      
 
Domain Number 19 Region: 63-104
Classification Level Classification E-value
Superfamily FnI-like domain 0.0000199
Family VWC domain 0.028
Further Details:      
 
Domain Number 20 Region: 1462-1510
Classification Level Classification E-value
Superfamily FnI-like domain 0.0000272
Family VWC domain 0.0075
Further Details:      
 
Domain Number 21 Region: 857-903
Classification Level Classification E-value
Superfamily FnI-like domain 0.0000314
Family VWC domain 0.0096
Further Details:      
 
Weak hits

Sequence:  ENSSSCP00000020592
Domain Number - Region: 1013-1049
Classification Level Classification E-value
Superfamily FnI-like domain 0.00178
Family Fibronectin type I module 0.048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000020592   Gene: ENSSSCG00000016574   Transcript: ENSSSCT00000027047
Sequence length 1994
Comment pep:known chromosome:Sscrofa10.2:18:20783680:20811231:1 gene:ENSSSCG00000016574 transcript:ENSSSCT00000027047 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PGLADSRDYQPQALAYSSAPARAPQELWRPLEERLGRLEAEVTQLREQNQVLQGRVRQLE
SCECHPASPQCWGLGRAWPEGARWEPDACTACVCQDGAARCDPKPGLPRCHGCSHNGQTY
GNGETFSTDACTTCRCLEGAVTCSQKPCPRGPCLEPGACCPHCEPGCPGGHRAGETWQPE
PCVICSCQAGTVRCQGPSCSELNCLESYTPPGECCPVCRPGCEYEGQLYEEGANFPSSSN
PCLQCSCLTSLVRCVPMKCPPVPCPEPVLRPGHCCPTCQGESPAPFLVALQAGPRRDFWS
PRCWPLTWLWQWGSHAWPHLLTICFVRRRYKVSPRGRALEGDPESHPSTQILQTDCPSVG
GLLSAHLPPAQGCTEGGSHQEHGQEWTTPGDPCRICQCLEGHIRCRQHECASLCPYPARP
LPGTCCPVCDGCFLNGQEYRSGEPVGSGDPCSHCRCANGSVQCEPLPCPATPCRYPGRIP
GKCCPVCDGESGARITREEGQTLAQERFQPLLRGVGEAGRVEDTHGDCPLSGLGVDASVP
LSSCPGCEYQGHQYQSQETFRLQESGRCVHCTCQAGEVSCEERECPVAPCALPDSGPQLC
PASPCVACVLDGEEFAEGVQWEPDGQPCMACSCQAGVPMCRALLCSPAPCQHPTRPLGAC
CPSCESCTYHGQVYANGQNFTDADSPCHACRCEDGTVTCSLVNCPPTTCARPQRGPGQCC
PRCPDCVLEKQVFVDGERFSHPRDPCQECQCQEGQAHCQPRVCPTASCAHPLPGPCCQHN
CNGCAFGGKEYPNGADFPHPSDPCRLCRCLSGNVQCLARRCPPLLCPEPAMLPGKCCPQC
PATPSSCPRPGSKVPAHHQEHFSPPDDPCHLCLCLDGSVSCQRLPCPPVPCTHPRQGPCC
PSCDGCQYQGKEFTSGERFPSPTARCHVCLCWEGSVRCEPRVCAPAQCPFPARGDCCPTC
DGCEYLGESYLSSQEFPDPRESCSRCTCLGGFVTCGRRPCEPLGCSHPLTLPGHCCPTCQ
GCLYHGVTAAPGETLPDPLDPTCSLCTCQVRRPCGSLGTLQRLIFLSGQKEVVASRRFSW
ARAAEGSMSCRKKPCPPALCPHPSPGPCFCPVCHSCLSHGREHQDGETFEGPPGSCERCR
CQAGQVSCARLPCPPLPCPLQVTEQGSCCPRCRAFPPPCPPLGPSHPSPSGSRLCPPSAL
PTCPCPPPAHTISPSRCFLESPQSCPVPNQTPFITRSFFSLSLSLFFGTFLTSVGPCCIH
CPAWYKNLQPLLTRLDPSTQCLSPPPQTGVLPQATSPPAEPALAPTCPADLPGAHPSTWA
AGCLVRGEEHPEGSSWEPPDSPCSSCMCHEGVITCARIQCVTSCAQPRQGPSDCCPRCSD
CEHKGRKYEPGESFQPGADPCEVCICELQPEGPPSVRCHRRQCPSLVGCPASQLLPPGPQ
HCCPTCAQALSHCTEGLLGSELALPGPCYTCQCQDLTWLCIQRACPELSCPLLERHTPSG
SCCPVCQECVVDVDGRRVADGESWQDPSNACITCTCRRGHVDCHLEECQALSCPHGWAKV
REAGRCCERCQAPAQSCLHQGQQVASGEHWAVDACTSCSCVAGTVRCHSQRCPLLFCNPD
EAPALNPGSCCPHCLPRPASCMAFGDPHYRTFDGRLLHFQGSCSYVLAKDCRGGNFSVHV
TNDDRGRSGVSWTQEVAVLLGDVTVQLLQGRVVTVDGRPVALPSLREPLLYAELRGRTVI
LHAQSGLQVLWDGQSQVEVRVPGSYRGQVCGLCGNFNGFAQDDLRGPEGMLLSTEAAFGN
SWQVPEGPGPGRPCSKGREVDPCRAAGYRARREANARCGVLKSSTFSRCHAVVPPEPFFA
ACVYDLCACGLGSAADTCLCDVLEAYASHCRQAGVTPAWRGPTLCVVGCPLDRGFMFDEC
GPPCPRTCFNQHVPLGELAAHCVRPCVPGCQCPAGLVEHEAHCIPPEACPQVLLTGDQLP
STLPSPSREPQGPP
Download sequence
Identical sequences ENSSSCP00000020592 ENSSSCP00000020592

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]