SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000020623 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000020623
Domain Number 1 Region: 130-177
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000000183
Family TSP-1 type 1 repeat 0.0013
Further Details:      
 
Domain Number 2 Region: 1219-1276
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000000275
Family TSP-1 type 1 repeat 0.0012
Further Details:      
 
Domain Number 3 Region: 566-630
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000183
Family TSP-1 type 1 repeat 0.0022
Further Details:      
 
Domain Number 4 Region: 967-1026
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000222
Family TSP-1 type 1 repeat 0.0023
Further Details:      
 
Domain Number 5 Region: 296-349
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000824
Family TSP-1 type 1 repeat 0.0034
Further Details:      
 
Domain Number 6 Region: 707-760
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000249
Family TSP-1 type 1 repeat 0.0046
Further Details:      
 
Domain Number 7 Region: 1350-1405
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000902
Family TSP-1 type 1 repeat 0.0031
Further Details:      
 
Domain Number 8 Region: 633-702
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000262
Family TSP-1 type 1 repeat 0.0076
Further Details:      
 
Domain Number 9 Region: 1097-1152
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000955
Family TSP-1 type 1 repeat 0.0058
Further Details:      
 
Domain Number 10 Region: 1271-1326
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000353
Family TSP-1 type 1 repeat 0.0074
Further Details:      
 
Domain Number 11 Region: 1025-1096
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000034
Family TSP-1 type 1 repeat 0.0035
Further Details:      
 
Domain Number 12 Region: 838-893
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000562
Family TSP-1 type 1 repeat 0.0075
Further Details:      
 
Weak hits

Sequence:  ENSSSCP00000020623
Domain Number - Region: 357-431
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000103
Family TSP-1 type 1 repeat 0.0069
Further Details:      
 
Domain Number - Region: 1154-1210
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000432
Family TSP-1 type 1 repeat 0.0046
Further Details:      
 
Domain Number - Region: 444-509
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00301
Family TSP-1 type 1 repeat 0.0072
Further Details:      
 
Domain Number - Region: 899-966
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0253
Family TSP-1 type 1 repeat 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000020623   Gene: ENSSSCG00000015350   Transcript: ENSSSCT00000024928
Sequence length 1593
Comment pep:known_by_projection chromosome:Sscrofa10.2:9:88921415:89309423:-1 gene:ENSSSCG00000015350 transcript:ENSSSCT00000024928 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GPWGRCMGDECGPGGIQTRAVWCAHSEGWTTLHTNCKQAERPSNQQNCFKVCDWHKELYD
WRLGPWNQCQPVISKSLEKPLECIKGEEGIQVREITCIQKEKDVPAEDIICEYFEPKPLL
EACLIPCQQDCIVSEFSAWSECSKTCGSGLQHRTRQVVAPPQFGGSGCPNLTEFQVCQSS
PCEAAESLYSLQVGPWSTCSMPHSRQVRQARRRGKNKERDKDRGKGVKDPEARELIKKKR
NRNRQNRQENKYWDIQIGYQTREVMCTNKTGKTADLSFCKQEKLPMTFQACVIMKECQVS
EWSEWSPCSKTCHDMASPKGTRVRMRLIRQFPIGSEKECPELEEKEPCVSQGDGVAPCAT
YSWRTTEWTECRVDPLLSQQDKRRGNQTALCGGGIQTREVYCVQAKQNLPSQLNTPKDKE
ASKPVDVKSCTGPVPNTTQLCHIPCPTECEVSPWTAWGPCTYENCNDQQGKKGFKLRKRR
ITNEPTGGSGGTGNCPHLLEAIPCEEPSCYDWKAVRLGDCEPDNGKECGPGTQVQEVVCI
NSDGEEVDRQLCRDAIFPIPVACDAPCPKDCVLSMWSAWSSCSHTCSGKTTEGKQIRARS
ILAYAGEEGGAQCPNSSALQEVRSCNEHPCTVYHWQTGPWGQCIEDTSVSSFNTTTTWNG
EASCSVGMQTRKVICVRVNVGQVGPKKCPESLRPETVRPCLLPCRKDCIVTPYSDWTPCP
SSCKEGDSGIRKQTRHRVVIQLPANGGRDCTDPLYEEKACEAPQVCQSYRWKTHKWRRCQ
LVPWSVQQESPGAQEGCGPGRQARAITCRKQDGGQASIHECLQNAGPVPALTQACQIPCQ
DDCQFTSWSKFSSCNGDCGAVRTRKRTIVGKSKKKEKCKNSHLYPLIETQYCPCDKYNAQ
PVGNWSDCILPEGKVEVLLGMKVQGDIKECGQGYRYQAMACYDQNGRLVETSRCNSHGYI
EEACIIPCPSDCKLSEWSNWSRCSKSCGSGVKVRSKWLREKPYNGGRPCPKLDHVNQAQV
YEVVPCHSDCNQYIWVTEPWSVCKVTFVNMRDNCGEGVQTRKVRCMQNTADGPSDHVEDY
LCDPEEMPLGSRECKLPCPEDCVISEWGPWTRCTLPCNQNSFRQRSADPIRQPADEGRAC
PDAIEKEPCNLNKNCFHYYYNVTDWSTCQLSEKAVCGNGIKTRMLDCVRSDGKSVNLKYC
EELGLEKNWQMNTSCMVECPVNCQLSDWSPWSECSQTCGLTGKMIRRRTVTQPFQGDGRP
CPALMEQSKPCPVKPCYQWQYGQWSPCKVQDAQCGEGTRTRNISCVVSDGSADDFSKVVD
DEFCTDTEPIIDGNKKMVLEESCTQPCPGDCYLKDWSSWSLCQLTCVNGEDLGFGGIQVR
SRAVIIQELENQYLCPEQMLETRPCDDGQCYEYKWMASAWKGSSRTVWCQRSDGVNVTGG
CLVVRQPDADRSCNPPCSQPHSYCSETRTCSCEEGYTEVMSSNGTLEQCTLIPVVVIPTV
EDKREDVKTSRAVHPTQPSSNPAGRGRTWFLQPFGPDGRLKTWVYGVAAGAFVLLIFIVS
MIYLACKKPKKPQRRQNNRLKPLTLAYDGDADM
Download sequence
Identical sequences ENSSSCP00000016278 ENSSSCP00000020623

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]