SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000020626 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSSSCP00000020626
Domain Number - Region: 36-95
Classification Level Classification E-value
Superfamily Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase 0.00461
Family Antibiotic resistance proteins 0.087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000020626   Gene: ENSSSCG00000029759   Transcript: ENSSSCT00000024045
Sequence length 99
Comment pep:novel chromosome:Sscrofa10.2:15:154359281:154360310:-1 gene:ENSSSCG00000029759 transcript:ENSSSCT00000024045 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGCQGSGLGKTKACLVPGLALCLLLGPLAGAKPVQDDRDPYAEPPALPYWPFSTSDFWSY
VQHLQALGAYPQLEDMARVFFAHFPLGTTLGFHAPYREE
Download sequence
Identical sequences XP_005672420.1.46622 XP_005672423.1.46622 XP_020931123.1.46622 XP_020931124.1.46622 ENSSSCP00000020626 ENSSSCP00000020626

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]