SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000020647 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000020647
Domain Number 1 Region: 807-918
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000000251
Family Growth factor receptor domain 0.0096
Further Details:      
 
Domain Number 2 Region: 201-373
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000118
Family Growth factor receptor domain 0.013
Further Details:      
 
Domain Number 3 Region: 367-410
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000000339
Family EGF-type module 0.002
Further Details:      
 
Domain Number 4 Region: 636-679
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000000982
Family EGF-type module 0.0048
Further Details:      
 
Domain Number 5 Region: 470-603
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000471
Family Growth factor receptor domain 0.011
Further Details:      
 
Domain Number 6 Region: 406-448
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000519
Family EGF-type module 0.0046
Further Details:      
 
Domain Number 7 Region: 671-794
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000235
Family Growth factor receptor domain 0.013
Further Details:      
 
Domain Number 8 Region: 170-213
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000931
Family EGF-type module 0.015
Further Details:      
 
Domain Number 9 Region: 1-140
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000173
Family Growth factor receptor domain 0.01
Further Details:      
 
Domain Number 10 Region: 1046-1083
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000554
Family EGF-type module 0.016
Further Details:      
 
Domain Number 11 Region: 133-174
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000732
Family EGF-type module 0.0052
Further Details:      
 
Domain Number 12 Region: 600-640
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000107
Family EGF-type module 0.0051
Further Details:      
 
Domain Number 13 Region: 957-1007
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000435
Family EGF-type module 0.013
Further Details:      
 
Domain Number 14 Region: 1095-1127
Classification Level Classification E-value
Superfamily Notch domain 0.000000418
Family Notch domain 0.0013
Further Details:      
 
Domain Number 15 Region: 1135-1167
Classification Level Classification E-value
Superfamily Notch domain 0.00000157
Family Notch domain 0.0065
Further Details:      
 
Weak hits

Sequence:  ENSSSCP00000020647
Domain Number - Region: 914-953
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000179
Family EGF-type module 0.01
Further Details:      
 
Domain Number - Region: 444-475
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000219
Family EGF-type module 0.016
Further Details:      
 
Domain Number - Region: 995-1034
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00339
Family EGF-type module 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000020647   Gene: ENSSSCG00000023899   Transcript: ENSSSCT00000025522
Sequence length 1175
Comment pep:known_by_projection chromosome:Sscrofa10.2:2:61892253:61904533:-1 gene:ENSSSCG00000023899 transcript:ENSSSCT00000025522 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
CPPGWVGEWCQLEDPCHSGPCAGRGVCQSSVVAGTARFSCRCPRGFRGPDCSLPDPCLSS
PCAHGARCSVGSDGRYICSCPPGYQGRSCRSDVDECRVGGPCRHGGTCLNTPGSFHCQCP
AGFTGPLCESPAVPCAPSPCRNGGTCRQSGDLTYDCACLPGFEGQNCEVNVDDCPGHRCL
NGGTCVDGVNTYNCQCPPEWTGQFCTEDVDECQLQPNACHNGGTCFNTLGGHSCVCVNGW
TGESCSQNIDDCATAVCFHGATCHDRVASFYCACPMGKTGLLCHLDDACVSNPCHEDAIC
DTNPVNGRAICTCPPGFTGGACDQDVDECSIGEAGANPCEHLGRCVNTQGSFLCQCGRGY
TGPRCETDVNECLSGPCRNQATCLDRIGQFTCICMAGFTGTYCEVDMDECQSSPCVNGGV
CKDKVNGFSCTCPSGFSGAMCQLDVDECASTPCRNGAKCVDQPDGFSCACAPGYTGTRCE
SQVDECRSQPCRHGGKCLDLVDKYLCRCPPGTTGPLCNMEINECASSPCGEGGSCVDGEN
GFRCLCPPGSLPPLCLPPSHPCAQEPCSHGVCHDAPGGFRCVCEPGWSGPQCSRQCELLS
PCVPNPCEHGGHCESATGSFSCTCHEGYSGPSCDQDINDCDPNPCLNGGSCQDGVGSFSC
SCLPGFAGPRCARDVDECLSSPCSCFNGGTCVDGVTSFTCLCRPGYTGAHCQHEADPCLS
RPCLHGGICTAAHPGFRCACPEGFTGAQCQTLVDWCSRVPCQNGGRCARAGASFYCLCPP
GWSGRLCDIQSLPCREAAAQIGVPVEQLCQAGGQCVDKDGSHYCVCPEGRTGSHCEQEVD
PCLAQPCQHGGTCQGYMGGYVCECPAGYTGDNCEDDVDECASQPCQHNGTCVDLVGGFRC
SCPPGYTGLRCEADINECRPGACHAAHTRDCLQDPGGGFHCLCHAGFTGPRCQTVLSPCE
SQPCQHGGQCRPSPGPGGALTFSCHCVLPFWGPRCERVARSCRELQCPVGVPCQQTVRGP
RCACPPGLSGPACRGSRGSPPGAVNSSCVTSPCLHGGSCRPESLAPFFRCACAPGWSGPR
CEVPVAAPEAPEEPPCPRAACEAKSGDKRCDRECNSPGCGWDGGDCSLSVGDPWRQCAAL
QCWLLFNNSRCDPACSSPACLYDNFDCRGRERTCK
Download sequence
Identical sequences ENSSSCP00000020647

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]