SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000020659 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000020659
Domain Number 1 Region: 43-349
Classification Level Classification E-value
Superfamily Cysteine proteinases 5.97e-70
Family Papain-like 0.0000114
Further Details:      
 
Domain Number 2 Region: 1-39
Classification Level Classification E-value
Superfamily FnI-like domain 0.00000199
Family VWC domain 0.064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000020659   Gene: ENSSSCG00000028642   Transcript: ENSSSCT00000031207
Sequence length 358
Comment pep:known_by_projection scaffold:Sscrofa10.2:JH118902.1:10793:65330:1 gene:ENSSSCG00000028642 transcript:ENSSSCT00000031207 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GCHRDGQHYEEGSVIKENCNSCTCSGQQWNCSQHVCLVQPGLIEHVNEGDFGWTAQNYSQ
FWGMTLEEGFKYRLGTLPPSPLLLSMNEVTASLPETTDLPEFFVASYKWPGWTHGPLDQK
NCAASWAFSTASVAADRIAIQSEGRYTANLSPQNLISCCAKNRHGCNSGSIDRAWWYLRK
RGLVSHACYPLFKDQNATNNGCAMASRSDGRGKRHATKPCPNNFEKSNRIYQCSPPYRVS
SNETEIMREIMQNGPVQAIMQVHEDFFHYKTGIYRHVTSTNEESDKYRKLRTHAVKLTGW
GTLKGAQGRKEKFWIAANSWGKSWGENGYFRILRGVNESDIEKLIIAAWGQLTNSDEP
Download sequence
Identical sequences ENSSSCP00000020659 ENSSSCP00000020659

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]