SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000020699 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000020699
Domain Number 1 Region: 176-290,409-526
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 1.63e-53
Family Phosphate binding protein-like 0.0000000112
Further Details:      
 
Domain Number 2 Region: 8-158
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 2.19e-21
Family L-arabinose binding protein-like 0.018
Further Details:      
 
Domain Number 3 Region: 304-410
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 0.00000419
Family Voltage-gated potassium channels 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000020699   Gene: ENSSSCG00000022569   Transcript: ENSSSCT00000032251
Sequence length 530
Comment pep:known_by_projection chromosome:Sscrofa10.2:16:75191952:75275676:1 gene:ENSSSCG00000022569 transcript:ENSSSCT00000032251 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQGFMDIDLNKFKESGANVTGFQLVNYTDTIPAKIMQQWKTSDARDHTRVDWKRPKYTSA
LTYDGVKVMAEAFQSLRRQRIDISRRGNAGDCLANPAVPWGQGIDIQRALQQVRFEGLTG
NVQFNEKGRRTNYTLHVIEMKHDGIRKIGYWNEDDKFVPAATDAQAGGDNSSVQNRTYIV
TTILEDPYVMLKKNANQFEGNDRYEGYCVELAAEIAKHVGYSYRLEIVSDGKYGARDPDT
KAWNGMVGELVYGRADVAVAPLTITLVREEVIDFSKPFMSLGISIMIKKPQKSKPGVFSF
LDPLAYEIWMCIVFAYIGVSVVLFLVSRFSPYEWHSEEFEEGRDQTTSDQSNEFGIFNSL
WFSLGAFMQQGCDISPRSLSGRIVGGVWWFFTLIIISSYTANLAAFLTERMVSPIESAED
LAKQTEIAYGTLEAGSTKEFFRRSKIAVFEKMWTYMKSAEPSVFVRTTEEGMIRVRKSKG
KYAYLLESTMNEYIEQRKPCDTMKVGGNLDSKGYGIATPKGSALRTSVGL
Download sequence
Identical sequences ENSSSCP00000020699 ENSSSCP00000020699

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]