SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000020747 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000020747
Domain Number 1 Region: 67-105
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000175
Family EGF-type module 0.016
Further Details:      
 
Domain Number 2 Region: 10-103
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000785
Family Growth factor receptor domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000020747   Gene: ENSSSCG00000027610   Transcript: ENSSSCT00000029894
Sequence length 133
Comment pep:novel chromosome:Sscrofa10.2:2:64708294:64726508:-1 gene:ENSSSCG00000027610 transcript:ENSSSCT00000029894 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRGSLLLPGLCFLLSLSGAVARKTTGTCHPCPQNAYCVNGTYCTCSHGYKSESGQIYFTF
PLETCKDIDECKPPINIYCGVNAKCQNTEGSFYCHCITGYRLLSGDEKFSNSSENTCQSK
KILVFLSLFMIFN
Download sequence
Identical sequences ENSSSCP00000020747 ENSSSCP00000020747

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]