SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000020773 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000020773
Domain Number 1 Region: 251-426,456-517
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 4.93e-44
Family Voltage-gated potassium channels 0.0025
Further Details:      
 
Domain Number 2 Region: 521-706
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 5.89e-42
Family cAMP-binding domain 0.00037
Further Details:      
 
Domain Number 3 Region: 38-131
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 2.27e-19
Family Flavin-binding PAS domain 0.0000187
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000020773   Gene: ENSSSCG00000017295   Transcript: ENSSSCT00000029983
Sequence length 959
Comment pep:known_by_projection chromosome:Sscrofa10.2:12:15341289:15361517:-1 gene:ENSSSCG00000017295 transcript:ENSSSCT00000029983 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPVRRGHVAPQNTYLDTIIRKFEGQSRKFLIANAQMENCAIIYCNDGFCELFGYSRVEVM
QRPCTCDFLTGPNTPRSAMSRLAQALLGAEECKVDILYYRKDASSFRCLVDVVPVKNEDG
AVIMFILNFEDLAQLLAKRGSRSLSQRLLSPSFLGSEGSHGRPGTQGPGPGRVKYRTISQ
IPQFTLNFVEFNLEKHRSGSTTEIEIIAPHKVVERTQNVTEKVTQVLSLGADVLPEYKLQ
APRIHRGTLLHYSPFKAVWDWLILLLVIYTAVFTPYSAAFLLSDQDESRRGDCGYTCSPL
TVVDLIVDIMFVVDIVINFRTTYVNTNDEVVSHPRRIAVHYFKGWFLIDMVAAIPFDLLI
FRTGSDETTTLIGLLKTARLLRLVRVARKLDRYSEYGAAVLFLLMCTFALIAHWLACIWY
AIGNVERPYLEPKIGWLDSLGAQLGKRYNGSDPASGPSVQDKYVTALYFTFSSLTSVGFG
NVSPNTNSEKVFSICVMLIGSLMYASIFGNVSAIIQRLYSGTARYHTQMLRVKEFIRFHQ
IPNPLRQRLEEYFQHAWSYTNGIDMNAVLKGFPECLQADICLHLHRALLQHCPAFHGASK
GCLRALAVKFKTTHAPPGDTLVHLGDVLSTLYFISRGSIEILRDDVVVAILAGKNDIFGE
PVSLHARPGKSSADVRALTYCDLHKIQRADLLEVLDMYPAFADSFWSKLEVTFNLRDAGG
GLQSSPQQASGSQDHQGFFLSDNQSAGAAPSLSISDASGLWPELLQQVPPRPSHSPPNPQ
GDPDCWPRELGSRLEQLQAQMNRLESRMSADLSRILQLLQQPLPQDHTGYILGAPASNDL
ALFPVSSVTQRPGAGLPQGDVPPAQTPSYGDSDEWSLKRSNSSSKLPPLAMDIDKTLTLC
SEEEQPEGLLSPLASPLHPLEVQGLVCGPRFPSLPEHLSSVPKQLEVQRHGSDPGFAGN
Download sequence
Identical sequences ENSSSCP00000020773

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]