SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000020796 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000020796
Domain Number 1 Region: 30-202
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 6.33e-37
Family SPRY domain 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000020796   Gene: ENSSSCG00000028066   Transcript: ENSSSCT00000028535
Sequence length 207
Comment pep:known chromosome:Sscrofa10.2:5:23527889:23529938:1 gene:ENSSSCG00000028066 transcript:ENSSSCT00000028535 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALPFARPLCLCRWGAKRLGIAAAETRRGVSFKLEEKTAHSSLALFKSDTGVKYGMVGLE
PTKLALNVERFREWAVVLADTAITSGRHYWEVTVKRSQQFRIGVADVDMSRDSCIGVDDR
SWVFTYAQRKWHTMLANEKAPIEGIGQPEKVGLLLEYEAQKLSLVDVNRVAVVHTLQTDF
RGPVVPAFALWDGELLTHSGLEVPEGL
Download sequence
Identical sequences I3L9T3
ENSSSCP00000020796 ENSSSCP00000020796 XP_003481678.1.46622

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]