SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000020853 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000020853
Domain Number 1 Region: 17-190
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.11e-29
Family Laminin G-like module 0.0024
Further Details:      
 
Domain Number 2 Region: 195-326
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.00000000000000554
Family Laminin G-like module 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000020853   Gene: ENSSSCG00000024050   Transcript: ENSSSCT00000023812
Sequence length 375
Comment pep:novel scaffold:Sscrofa10.2:GL893597.1:6927:15515:1 gene:ENSSSCG00000024050 transcript:ENSSSCT00000023812 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SIVAMSRFFIFKTDSFWNSASFNTETSYLHFPTFRGELSADVSFFFKTTASSGVFVENLG
ITDFIRLELRAPAEVTFSFDVGNGPCEVTVPSPTPFNDNRWHHVKAERNIKEASLQVVSF
PYHLNSEPAGGIIRIGLGSNVCFVGGTAGRQRGFLGCMRSLQLNGLALDLEERATMTPGV
EPGCPGHCSSYGHLCRNGGRCREKHRGITCDCTSSAYDGPFCENEISAYFGTGSSVIYNF
QEHYYHTFDKNSSSFAVLSHEDLTLTRETVTLSFRTTATPSLLLYVSSFHEEYLSVILAP
NEVLLTQVNISVHMNKLVLQFILKDDLSAFYMANTSSSLEVRKCIKVNQNARRQAILSSG
TEFNAVKSLILGTIL
Download sequence
Identical sequences ENSSSCP00000020853 ENSSSCP00000020853

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]