SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000020913 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000020913
Domain Number 1 Region: 267-315,377-674
Classification Level Classification E-value
Superfamily Cysteine proteinases 1.47e-90
Family Ubiquitin carboxyl-terminal hydrolase, UCH 0.000019
Further Details:      
 
Domain Number 2 Region: 4-99
Classification Level Classification E-value
Superfamily RING/U-box 7.77e-27
Family Zf-UBP 0.005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000020913   Gene: ENSSSCG00000021307   Transcript: ENSSSCT00000025589
Sequence length 709
Comment pep:known chromosome:Sscrofa10.2:5:92078203:92094050:1 gene:ENSSSCG00000021307 transcript:ENSSSCT00000025589 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLTMDKCKHIGRLQLAHDHSILNPQKWHCVDCNTTESIWACLSCPHVACGRYIEEHALKH
FQESSHPVALEVNEMYVFCYFCDDYVLNDNATGDLKLLRSTLSAIKSQSYHCTTRSGRVL
RSVGTSDDSDFLHDGAQSLLQNEDQMYTALWHRRRILMGKIFRTWFEQSPIGRKRQEDQF
QEKIAKREVKKRRQELEYQVEAELESMPPRKSLRLQGLAQSTTVEIVPVQVPLQTSASPV
KVVSTSEDVRLKKASDFSVKRRPIVTPGVTGLRNLGNTCYMNSVLQVLSHLLIFRQCFLK
LDLNRWLSVTANDKTRSSYKHLPVTDTVYQMNDCQEKETGSLHSRYPSLSLGLSGGASKS
RKMELIQPREPSSQYISLCHELHTLFQVMWSGKWALVSPFAMLHSVWRLIPAFRGYAQQD
AQEFLCELLDKIQHELETTGTRLPALIPTSQRKLIKQVLNVVNNIFHGQLLSQVTCLACD
NKSNTIEPFWDLSLEFPERYQCSGKDIASQPCLVTEMLAKFTETEALEGKIYVCDQCNSK
RRRFSSKPVVLTEAQKQLMICHLPQVLRLHLKRFRWSGHNNREKIGVHVGFEEILNMEPY
CCRESLKSLRPECFIYDLAAVVMHHGKGFGSGHYTAYCYNSEGGFWVHCNDSKLSMCTMD
EVCKAQAYILFYTQRVAENGHSKLLPPELLSGSQHPSEEADTSSNEILS
Download sequence
Identical sequences I3LA47
ENSSSCP00000020913 XP_005664302.1.46622 ENSSSCP00000020913

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]