SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000020936 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000020936
Domain Number 1 Region: 5-245
Classification Level Classification E-value
Superfamily Carbonic anhydrase 1.31e-63
Family Carbonic anhydrase 0.00000094
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000020936   Gene: ENSSSCG00000022094   Transcript: ENSSSCT00000029058
Sequence length 269
Comment pep:known_by_projection scaffold:Sscrofa10.2:GL896432.1:46369:54370:-1 gene:ENSSSCG00000022094 transcript:ENSSSCT00000029058 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTGHHGWGYGQNDAPXSDERSHSYFSGERQRRPPITNQYRIQPSCVLTXPSLKPLELSYE
SCTSLSIANNGHSVQVDFNDSDDRTACCGGGGSSALPLKNLRLRWAGRDSSHSKYRVSGS
VVYAELHLVHWNAKKYSTFGEAASAPDGLAVVGVFLETGDEHPSMNRLTDALYMVRFKGT
KAQFSCFNPKCLLPASRHYWTYPGSLTTPPLSESVTWIVLREPISISEKQMEKFRSLLFT
SEEGEQSAWYVPGWRGASVGARKPRQEMF
Download sequence
Identical sequences ENSSSCP00000020936 ENSSSCP00000020936

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]