SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000020958 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000020958
Domain Number 1 Region: 41-100
Classification Level Classification E-value
Superfamily FnI-like domain 0.00000000000000241
Family VWC domain 0.00018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000020958   Gene: ENSSSCG00000021015   Transcript: ENSSSCT00000029554
Sequence length 109
Comment pep:novel chromosome:Sscrofa10.2:12:26417119:26419206:-1 gene:ENSSSCG00000021015 transcript:ENSSSCT00000029554 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFSFVDLRLLLLLAATALLTHGQEEGQEEGQQGQEEDIPPVTCVQNGLRYHDRDVWKPVP
CQICVCDNGNVLCDDVICDEIKNCPSARVPAGECCPVCPEGEGIARDLG
Download sequence
Identical sequences ENSSSCP00000020958 ENSSSCP00000020958

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]