SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000020964 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000020964
Domain Number 1 Region: 1-172
Classification Level Classification E-value
Superfamily Cysteine proteinases 1.54e-71
Family Transglutaminase core 0.0000000182
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000020964   Gene: ENSSSCG00000027136   Transcript: ENSSSCT00000030254
Sequence length 185
Comment pep:novel chromosome:Sscrofa10.2:7:3672185:3696076:1 gene:ENSSSCG00000027136 transcript:ENSSSCT00000030254 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VNAKDDEGVLVGSWDNVYSYGVPPSAWTGSVDILLEYKSSQTPVRYGQCWVFAGVFNTFL
RCLGIPARVVTNYFSAHDNNANLQLDIFLEEDGNVNSKLTKDSVWNYHCWNEAWMTRPDL
PVGFGGWQVVDSTPQENSDGMYRCGPASVQAIKHGHVCFQFDAPFVFAEVRAWLGRSCSP
PLPLP
Download sequence
Identical sequences ENSSSCP00000020964 ENSSSCP00000020964

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]