SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000021021 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000021021
Domain Number 1 Region: 100-176
Classification Level Classification E-value
Superfamily FnI-like domain 0.000000000178
Family VWC domain 0.022
Further Details:      
 
Domain Number 2 Region: 443-500
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.00000000392
Family BSTI 0.047
Further Details:      
 
Domain Number 3 Region: 53-106
Classification Level Classification E-value
Superfamily FnI-like domain 0.00000764
Family VWC domain 0.024
Further Details:      
 
Weak hits

Sequence:  ENSSSCP00000021021
Domain Number - Region: 3-43
Classification Level Classification E-value
Superfamily FnI-like domain 0.000921
Family VWC domain 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000021021   Gene: ENSSSCG00000016665   Transcript: ENSSSCT00000023205
Sequence length 502
Comment pep:known_by_projection chromosome:Sscrofa10.2:18:43216779:43329478:-1 gene:ENSSSCG00000016665 transcript:ENSSSCT00000023205 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RCFVCMGLGEGRTQCLREVCPILSCPQHLSHIPPGQCCPRCLGQRKVFDLPFGSCLFRSD
VYDNGSSFLYDNCTACTCRDSTVVCKKKCSQPGGCDRGEGACCEECLLRVPSEDIKMCKF
GNKIFRDGEMWSSINCTICACVKGQTECRKKQCVPISSCPQGKILNRKGCCPICTEKPGV
CTVFGDPHYNTFDGRTFNFQGTCQYVLTKDCSSPASPFQVLVKNDARRTRSFSWTKSVDL
VLGTSTVSLQQHLTVRWNGSRIALPCQAPQFHIDLDGYLLKVTTKAGLEISWDGDSFVEV
MAAPHLKGKLCGLCGNYNGHKRDDLIGGDGNFKFDVDDFAESWRVESNEFCNRPQRKPVP
ELCQGTVRVKLRAHRECQKLKSWEFQTCHSTVDYATFYRSCVTDMCECPVHKNCYCESFL
AYTRACQREGISVHWEPQQTCAATQCKHGAVYDTCGPGCVKTCDNWNEIGPCNKPCVAGC
HCPANLVLHKGRCIKPVLCPQR
Download sequence
Identical sequences ENSSSCP00000021021

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]