SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000021030 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000021030
Domain Number 1 Region: 468-660
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.85e-48
Family SPRY domain 0.0000347
Further Details:      
 
Domain Number 2 Region: 275-326
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.0000000458
Family B-box zinc-binding domain 0.0035
Further Details:      
 
Domain Number 3 Region: 209-261
Classification Level Classification E-value
Superfamily RING/U-box 0.0000333
Family RING finger domain, C3HC4 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000021030   Gene: ENSSSCG00000027645   Transcript: ENSSSCT00000029113
Sequence length 662
Comment pep:novel scaffold:Sscrofa10.2:JH118988.1:19744:44970:1 gene:ENSSSCG00000027645 transcript:ENSSSCT00000029113 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
HHTFLMEEVAQEYQERFQESLKKLRQEQQEAEKLAALIREKRASWKNQMEPERHRIQKQF
DQLRSILDKEEQRQLRKLEEEERKGLSVIAEAEGELLQQSQSLRELISDLERRCQGSMTE
LLQNILHINQKSEFWTLKKPEALPTKLKSVFRAPDLKKMLRVFRELTDVQSYWGKQGKCS
TNTRRASVVWTGRSEGGSSCYGFTHPVITQKGVSCSVCWELSTEXFCPACISDSREARGC
PVCGVSYSLGNQRLPSIVEHPREVGMSPEDGWKEDQKLLLLCREDREVFCLCCEKTQEHR
DHHLCLIRDAAKECQEMLQAALRRLQKEQQKAEELEADIREQRTSCKYQMQTERQRIRSE
FNQLRCILDCEERRELQKLEEEERKTLDNLAAAEAELVQQTWLLKDLISDLECRREWPTQ
ELLQDTSGTMKWCEIWTLRKPKLVSKKLRRVFRAPDLGAMLQAQRELTHVQCYWEDITLD
PFNLNLNLVLSEDQRQVISVPIWPVKCYNYGVLGSQCFSSGKHYWEVDVSKKTAWVLGVY
CRARSCTAELALGRGAEHQNAHAIYRPQCGYWVIGLKNAFKYKAFEDASTCDLNVLTLSG
AVPPLRVGVFLDCEAGTVSFFNVTNYGSLIYRFSKCSFSQNVYPYFNPWNCPAPMTLCPP
SS
Download sequence
Identical sequences ENSSSCP00000021030 ENSSSCP00000021030

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]