SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000021031 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000021031
Domain Number 1 Region: 2-51
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000000196
Family TSP-1 type 1 repeat 0.0035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000021031   Gene: ENSSSCG00000022974   Transcript: ENSSSCT00000029177
Sequence length 111
Comment pep:known scaffold:Sscrofa10.2:JH118491.1:6852:29837:1 gene:ENSSSCG00000022974 transcript:ENSSSCT00000029177 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGDWSKCSITCGKGMQSRVIQCMHKITGRHGNECFSSEKPAAYRPCHLQPCNEKINVNTI
TSPRLAALTFKCLGDQWPVYCRVIREKNLCQDMRWYQRCCETCRDFYAQKL
Download sequence
Identical sequences ENSSSCP00000021031 ENSSSCP00000021031

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]