SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000021060 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000021060
Domain Number 1 Region: 7-113
Classification Level Classification E-value
Superfamily Cysteine proteinases 7.06e-29
Family Ubiquitin carboxyl-terminal hydrolase, UCH 0.00011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000021060   Gene: ENSSSCG00000021199   Transcript: ENSSSCT00000029294
Sequence length 122
Comment pep:novel chromosome:Sscrofa10.2:2:50877874:50901089:-1 gene:ENSSSCG00000021199 transcript:ENSSSCT00000029294 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFVCFFFKGYVGLVNQAMTCYLNSLLQTLFMTPEFRNALYKWEFEESEEDPVMSIPYQLQ
RLFVLLQTSKKRAIETTDVTRSFGWDSSEAWQQHDVQELCRVMFDALEQKWKQTEQVIYF
SG
Download sequence
Identical sequences ENSSSCP00000021060 ENSSSCP00000021060

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]