SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000021077 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000021077
Domain Number 1 Region: 85-287
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 3.67e-48
Family Reprolysin-like 0.0022
Further Details:      
 
Domain Number 2 Region: 379-434
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000000000209
Family TSP-1 type 1 repeat 0.00034
Further Details:      
 
Domain Number 3 Region: 794-847
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000128
Family TSP-1 type 1 repeat 0.0024
Further Details:      
 
Domain Number 4 Region: 727-794
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000366
Family TSP-1 type 1 repeat 0.0034
Further Details:      
 
Domain Number 5 Region: 675-732
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000196
Family TSP-1 type 1 repeat 0.0053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000021077   Gene: ENSSSCG00000024043   Transcript: ENSSSCT00000022836
Sequence length 1030
Comment pep:known_by_projection chromosome:Sscrofa10.2:2:80749844:81010536:1 gene:ENSSSCG00000024043 transcript:ENSSSCT00000022836 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDEEEFFIEPLEKGLAEKEAEQGRVHVVYRRPPTSRPPPLGGPQALDTGAPPASLDSLSQ
ALGILEEHVNSSRRRARRHAADDDYNIEVLLGVDDSVVQFHGKEHVQKYLLTLMNIVNEI
YHDESLGAHINVVLVRIILLSYGKSMSLIEIGNPSQSLENVCRWAYLQQKPDTGHEEYHD
HAIFLTRQDFGPSGMQGYAPVTGMCHPVRSCTLNHEDGFSSAFVVAHETGHVLGMEHDGQ
GNRCGDEVRLGSIMAPLVQAAFHRFHWSRCSQQELSRYLHSYDCLRDDPFAHDWPALPQL
PGLHYSMNEQCRFDFGLGYMMCTAFRTFDPCKQLWCSHPDNPYFCKTKKGPPLDGTMCAP
GKHCFKGHCIWLTPDILKRDGNWGAWSPFGSCSRTCGTGVKFRTRQCDNPHPANGGRTCS
GLAYDFQLCNSQDCPDALADFREEQCRQWDLYFEHGDAQHHWLPHEHRDAKERCHLYCES
KETGEVVSMKRMVHDGTRCSYKDAFSLCVRGDCRKVGCDGVIGSSKQEDKCGVCGGDNSH
CKVVKGTFTRAPKKLGYIKMFEIPAGARHLLIQEADTTSHHLAVKNLETGKFILNEENDV
DPNSKSFIAMGVEWEYRDEDGRETLQTTGPLHGTITVLVIPQGDARISLTYKYMIHEDSL
NVDDNNVLEDDSVGYEWALKKWSPCSKPCGGGSQFTKYGCRRRLDHKMVHRGFCDALSKP
KAIRRACNPQECSQPVWVTGEWEPCSQSCGRTGMQTRSVRCMQPLHNNTTRSVHTKHCND
ARPEGRRACNRELCPGRWRAGPWSQCSVTCGNGTQERPVLCRTSDNSFGVCREERPETAR
ICRLGPCPRNISDPSKKSYVVQWLSRPDPDSPVQKPSSKSHCQGDKSMFCRMEVLSRYCS
IPGYNKLCCKSCNLHDNLTDVDGGAEPPPGKHNDIEELVPTLPVPTLVMEVQPPPSTPLE
VPLNTSSTNATEDHPETNAVDVPYKIHGLEDEVQPPNLIPRRPSPYEKTRNQRIQELIDE
MRKKEMLGKL
Download sequence
Identical sequences ENSSSCP00000021077 XP_003123699.5.46622 ENSSSCP00000021077

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]