SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000021088 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000021088
Domain Number 1 Region: 429-615
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 9.89e-36
Family SPRY domain 0.0035
Further Details:      
 
Domain Number 2 Region: 58-135
Classification Level Classification E-value
Superfamily RING/U-box 2.12e-18
Family RING finger domain, C3HC4 0.013
Further Details:      
 
Domain Number 3 Region: 194-259
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.0000000000000382
Family B-box zinc-binding domain 0.00047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000021088   Gene: ENSSSCG00000017216   Transcript: ENSSSCT00000030867
Sequence length 621
Comment pep:known chromosome:Sscrofa10.2:12:6227159:6232342:-1 gene:ENSSSCG00000017216 transcript:ENSSSCT00000030867 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LLRFFPSLHRAAKPPVSGLLDMQRVSRPVQDHIPAPQPSPQPSRRPQGQFLMNHNHLQMF
EDQVLCPICLEVFRHPVTTACGHNFCMTCLQGFWDHQATLGEALYCPQCRESIPSRPRLC
KNVTLEEMVACLTQAKGQALGSSPNLAGPRDVPCDFCSPQKLKSVKSCLQCMASLCEKHL
RSHFEDQVFQGHQLLEPVWDLKSRLCRKHRKLRRLYCRTEGSCVCGACLLEEHKNHDTIP
LEEERARKEVEVRKVQANVENQMLIVTSDSQKHRGQMAFLSKLTQTTRDEVNTCFSEIIQ
EIKQLQMKVLDFVEKEEAAALGKLGSSIQQSHNRLLKLEGDSIWLRTLLSSRSDQQFLQD
FSRLKHFPACLEPLMGTSCEEKQSFLQLPETLAELRTRLMDVGLSFINQILLKGIKMNAY
EVLPPAVDRKTLLQCYCNLSFDPTTASEELFLFKETHSVLNLGILLEPFAAGGPFPGFKQ
WPQVLCSRGLAAGRHYWEAEVSNSWVCLGVTYRRSPPLSGRPRRNIVYLLGRNPYSWCLE
WDSLKFSVWHNNTQTVLHGGYHRTLGVALDCGAGCLSFYGVAVAGGVSLIYRFLAAFLEP
LYPAVMVSSGASVTLKQHPES
Download sequence
Identical sequences ENSSSCP00000021088 ENSSSCP00000021088

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]