SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000021092 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000021092
Domain Number 1 Region: 9-303
Classification Level Classification E-value
Superfamily Cysteine proteinases 7.11e-91
Family Calpain large subunit, catalytic domain (domain II) 0.00000139
Further Details:      
 
Domain Number 2 Region: 484-641
Classification Level Classification E-value
Superfamily EF-hand 0.000000000137
Family Penta-EF-hand proteins 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000021092   Gene: ENSSSCG00000020986   Transcript: ENSSSCT00000026249
Sequence length 643
Comment pep:known_by_projection scaffold:Sscrofa10.2:GL893019.2:17638:60376:1 gene:ENSSSCG00000020986 transcript:ENSSSCT00000026249 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MARNQEPLTQTSVIKLKEQDFYSLRDHCLKRGVLFEDETFPADTYSIGLQLLKGKNLSSL
SWIRPKDLLKGKSEPHFILEGASRFDIQQGDAGDCWFLAALGSLTQNPQHLQKILTDQSF
SYHYAGIFLFRFWQCGQWVEVVIEEFLFVHPRNKREFWPCLLEKAYAKFHGSYANLHYGY
LSDALMDLSGGVVTNIRLHSSSSDLMMMVKTAAEAGSLITCGTLAGPTSESTMMVNGLVS
RHAYTVTGAEKIQYRKSWEYLIRLWNPWGRMEWRGPWSDGYGFWKPLSPSWRRGVTETLF
REGSICHAWCGSHCRSVQPTPLCDCQSISHSRDAISEGLYGSPEIVETHQLQQPSARENV
LCKEKCGAFRPPREQAPAGSENQCNRLDSRYFPIQTHTYILANTVSGLPGTSFHHNYSSL
QCSDGISALLLGAAMLETLHLIQAFLKTPLPPPHPKSGYSSLALMRVTQNTGSDSSLHHP
SHRGRFLDATQLQSLLNQEFLKGSPGDTFSLDECRGIVALMDLEVNGRLNEQEFSRLWRR
LVHCQSVFWNARKNSGVFLSSDLQKAIQDTDFLAGVSVTSELLDLSTNPHSSGPHSSALR
ISGPRPVLIPLLLFTLEAFQNLSQDGKGLYLTKMEWMNLVMYN
Download sequence
Identical sequences ENSSSCP00000021092

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]