SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000021111 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000021111
Domain Number 1 Region: 4-277
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 6.41e-51
Family Rhodopsin-like 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000021111   Gene: ENSSSCG00000024282   Transcript: ENSSSCT00000030352
Sequence length 278
Comment pep:novel chromosome:Sscrofa10.2:6:40305180:40306031:-1 gene:ENSSSCG00000024282 transcript:ENSSSCT00000030352 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SLGLLFIYVLSFLFGLPANLLALRAFVGRVRQPHPAPIHILLLSLTLADLLLLLLLPFKV
IEAAYDFRWPLGDTLCALTGYGFYSGIYCSTWLLAGISIERYRSVAFPVQYKLSRRPLYG
VIVALVSWIIIVIIVQYLPTNTSTGNAEGLISCYDNFTKEQLDVVLPVRLELCLVLFFIP
MVVTIFCYWRFVWIILSQPHVESRKRWRAVGLVVVTLFNFLVCFGPYNVSHVVGYFQKTS
ESWRACAVMLSTLNACIDPLIFYFSSSAVRKAFDKKLR
Download sequence
Identical sequences ENSSSCP00000021111 ENSSSCP00000021111

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]