SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000021132 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000021132
Domain Number 1 Region: 105-256
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.73e-26
Family Clostridium neurotoxins, the second last domain 0.0089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000021132   Gene: ENSSSCG00000021491   Transcript: ENSSSCT00000025566
Sequence length 261
Comment pep:novel chromosome:Sscrofa10.2:8:82853006:82867324:-1 gene:ENSSSCG00000021491 transcript:ENSSSCT00000025566 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNFIIQEGESIICMVDLLEKCDVTCQAEVWSMFTAILKKSIRNLQICTEVGLVEKVLGQI
EKADSMIADLLVDMLGVLASYNLTVRELKLFFSKLQGDKGQWPPHAGKLLSVLKHMPQKY
GPDAFFNFPGKSAAAIALPPIAKWPYQNGFTFHTWLRMDPVNNINVDKDKPYLYCFRTSK
GLGYSAHFVGGCLIITSIKSKGKGFQHCVKFDFKPQKWYMVTIVHIYNRWKNSELRCYVN
GELASYGEITWFVNTSDVSNL
Download sequence
Identical sequences ENSSSCP00000021132 ENSSSCP00000021132

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]