SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000021212 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000021212
Domain Number 1 Region: 34-246
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.74e-63
Family SPRY domain 0.0000000161
Further Details:      
 
Domain Number 2 Region: 235-272
Classification Level Classification E-value
Superfamily SOCS box-like 0.0000136
Family SOCS box-like 0.0064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000021212   Gene: ENSSSCG00000028303   Transcript: ENSSSCT00000030642
Sequence length 273
Comment pep:known_by_projection chromosome:Sscrofa10.2:13:89710935:89769858:1 gene:ENSSSCG00000028303 transcript:ENSSSCT00000030642 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGQKLSGSLKSVEVREPALRPAKRELRGVEPGRPARLDQLLDMPAAGLAVQLRHAWNPED
RSLNVFVKDDDRLTFHRHPVAQSTDGIRGKVGHARGLHAWQIHWPARQRGTHAVVGVATA
RAPLHSVGYTALVGSDAESWGWDLGRSRLYHDGKNRPGVAYPAFLGPEEAFALPDSLLVV
LDMDEGTLSFVVDGQYLGVAFRGLKGKKLYPVVSAVWGHCEVTMRYINGLDPEPLPLMDL
CRRSIRLALGRQRLQDIGSLPLPQSLKNYLQYQ
Download sequence
Identical sequences ENSSSCP00000021212 ENSSSCP00000021212

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]