SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000021252 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000021252
Domain Number 1 Region: 3-55
Classification Level Classification E-value
Superfamily Cysteine proteinases 0.0000000000104
Family Calpain large subunit, catalytic domain (domain II) 0.0073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000021252   Gene: ENSSSCG00000029739   Transcript: ENSSSCT00000022762
Sequence length 122
Comment pep:novel chromosome:Sscrofa10.2:3:115216130:115245811:1 gene:ENSSSCG00000029739 transcript:ENSSSCT00000022762 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPRSPEWQETHDPRKSQLYENKDNGEFWMSCRDFQENFSCLFVCNQVPISLDHGNTPHEK
WSQVTLKNHIIPGNTAEPQRQHVFSVPDSMETNNVIVSFNIKPQNVKAKGRTFPLKFEVF
KV
Download sequence
Identical sequences ENSSSCP00000021252 ENSSSCP00000021252

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]